KURZANLEITUNGEN SHORT INSTRUCTIONS GUIDE RAPIDES GUIDA RAPIDA GUÌA RÀPIDA - www.sommer.eu

 
CONTINUER À LIRE
KURZANLEITUNGEN
SHORT INSTRUCTIONS
GUIDE RAPIDES
GUIDA RAPIDA
GUÌA RÀPIDA

S12622-00000_0-DRE_Rev-A_DE-EN-FR-ES-IT   www.sommer.eu   som4.me/man
Adapter für Schubarm                                         1        Adapter for push arm                                         1
Anbindung Home Automation                                    2        Interface Home Automation                                    2
Beschlag für Torrahmen                                       4        Door frame bracket                                           4
Bowdenzug Set                                                6        Bowden wire                                                  6
Elektroschloss                                               8        Electric lock                                                8
Entriegelung Set                                             10       Release set                                                  10
Beschlag für Flügeltor                                       12       Folding gate armature                                        12
*XPPLSUR¿OSDVVLY                                           5XEEHUSUR¿OHSDVVLYH                               
HomeLink Modul                                               16, 18   HomeLink module                                              16,18
Isolator mit Magnet Set                                      20, 22   Set, isolator with magnet                                    20, 22
LIFTer Montagelaufwagen                                      23       LIFTer Installation carriage                                 23
LUMI Line                                                    25       LUMI Line                                                    25
LUMI Stick                                                   27       LUMI Stick                                                   27
LUMI Strip                                                   29       LUMI Strip                                                   29
Laser                                                        31       Laser                                                        31
Laufschiene Deckenaufhängung                                 33       Ceiling bracket track                                        33
Kontaktfeder Set                                             34       Motor carriage contact spring set                            34
Montagebeschlag                                              36       Fittings                                                     36
DeltaDore X3D - Modul                                        38       DeltaDore X3D - Module                                       38
6FKLHQHQYHUOlQJHUXQJIU*DUDJHQWRUDQWULHEH                Rail extension for garage door operators                     39, 40
Schlupftürschalter Set                                       41       Wicket door switch set                                       41
Sektionaltorbeschlag                                         43, 44   6HFWLRQDOGRRU¿WWLQJ                                
Demontage des Laufwagens                                     45       Disassembly of the carriage                                  45
Einsatz Deckenhalter                                         47       Ceiling holder insert                                        47
Kabelhalter                                                  48       Cable holder                                                 48
Kabelhalter Set                                              50       Cable holder set                                             50
Klebesockel Set                                              52       $GKHVLYHVRFNHWVHW                                  
Leitungsführung Set                                          54, 56   Cable routing set                                            54, 56
Leitungsführungskanal Set                                    58       Cable routing duct set                                       58
Lock SKG                                                     60       Lock SKG                                                     60
Motion                                                       61       Motion                                                       61
Niedrigsturzbeschlag                                         62       ORZKHDGURRP¿WWLQJ                                  
Adaptateur pour bras de poussée                                          1        Adattatore per braccio di spinta                                1
Liaison Domotique                                                        2        Collegamenti Home Automation                                    2
Ferrure pour cadre de porte                                              4        Ferramenta per telaio della porta                               4
Câble Bowden                                                             6        Tirante Bowden                                                  6
Serrure électrique                                                       8        Elettroserratura                                                8
.LWGHGpYHUURXLOODJH                                                   Set sblocco                                                     10
Ferrure pour portes battantes                                            12       Ferratura per cancello ad anta                                  12
3UR¿OpHQFDRXWFKRXFSDVVLI                                             3UR¿ORGLJRPPDSDVVLYR                                  
HomeLink module                                                          16,18    HomeLink module                                                 16,18
.LWLVRODWHXUDYHFDLPDQW                                            Isolatore con kit magneti                                       20, 22
LIFTer Chariot de montage                                                23       LIFTer Slitta motore                                            23
LUMI Line                                                                25       LUMI Line                                                       25
LUMI Stick                                                               27       LUMI Stick                                                      27
LUMI Strip                                                               29       LUMI Strip                                                      29
Laser                                                                    31       Laser                                                           31
Roulement suspension plafonnière                                         33       VWDႇDGL¿VVDJJLRDVRI¿WWR                              
Kit de ressorts de contact pour chariot                                  34       Set molla di contatto slitta motore                             34
Support de montage                                                       36       6WDႇHGLPRQWDJJLR                                      
DeltaDore X3D - Module                                                   38       DeltaDore X3D - Modulo                                          38
Kit de rallonge rail et chaîne pour monteurs de portes de gargages       39, 40   Prolunga per asta                                               39, 40
Kit commutateur de porte de passage                                      40       Set interruttore per porta pedonale                             41
Ferrure de porte sectionnelle                                            43, 44   Ferratura per il cancello a serranda                            43, 44
Démontage du chariot                                                     45       Smontaggio della slitta motore                                  45
Ferrure de pièce de support de plafond                                   47       ,QVHUWRVXSSRUWRDVRႈWWR                                
Support de cable                                                         48       3RUWDFDYR                                              
Kit serre-câbles                                                         50       6HWIHUPDFDYL                                          
Kit socole adhésif                                                       52       6HWEDVHDGHVLYD                                        
Passe-câbles                                                             54, 56   6HWJXLGDFDYL                                          
Kit goulotte de câbles                                                   58       6HWFDQDOLQDJXLGDFDYL                                  
Lock SKG                                                                 60       Lock SKG                                                        60
Motion                                                                   61       Motion                                                          61
ferrure pour faible retombée de linteau                                  62       EDUDFFLRGLVSLQWDSHUDUFKLWUDYLULEDVVDWL               
Adaptador para brazo de empuje                               1
Conexion Home Automation                                     2                           GEFAHR
Herraje para marcos de puerta                                4        Die Kurzanleitung ersetzt nicht die Montage- und
transmisión Bowden                                           6        Betriebsanleitung.
Cierre eléctrico                                             8        Lesen Sie diese Montage- und Betriebsanleitung
                                                                      aufmerksam durch und beachten Sie insbesondere
Juego de desbloqueo                                          10
                                                                      alle Sicherheits und Warnhinweise.
Herraje para puertas de hojas giratorias                     12       Damit können Sie sicher und optimal das Produkt
3HU¿OGHJRPDSDVLYR                                       montieren.
HomeLink módulo                                              16
Juego de aislador con imán                                   20, 22
LIFTer Carro de montaje                                      23                          DANGER
LUMI Line                                                    25       The short instructions do not replace the instal-
LUMI Stick                                                   27       lation and operating manual.
LUMI Strip                                                   29       Read this Installation and Operating Manual care-
Laser                                                        31       IXOO\DQGPRVWLPSRUWDQWO\REVHUYHDOOVDIHW\LQVWUXF-   som4.me/man
Suspensión del techo                                         33       tions and
Juego de resortes de contacto para carro                     34       warnings.
Herraje de montaje                                           36       This will ensure that you can install the product
                                                                      safely and optimally
DeltaDore X3D - Módulo                                       38
Prolongaciòn de riel                                         39, 40
                                                                                         DANGER
Juego de interruptor de puerta peatonal                      41
Herraje de puerta seccional                                  43, 44   Le guide de montage rapide ne remplace en
                                                                      aucun cas la notice de montage et de service.
Desmontaje del carro                                         45
                                                                      /LVH]DWWHQWLYHPHQWFHWWHQRWLFHGHPRQWDJHHWGH
Uso de soporte de techo                                      47       VHUYLFHHWUHVSHFWH]WRXWHVOHVPLVHVHQJDUGHVHW
Soporte para cables                                          48       consignes
Juego de soporte para cables                                 50       de sécurité.
-XHJRGHRSRUWHDGKHVLYR                                     $LQVLYRXVSRXUUH]PRQWHUHWXWLOLVHUOHSURGXLWHQ
Juego de guía de cables                                      54, 56   toute sécurité et de manière optimale.
Juego de canal de guiado de cables,                          58
Lock SKG                                                     60                        PERICOLO
Motion                                                       61       La guida rapida non sostituisce le istruzioni per
herraje para dintel bajo                                     62       l‘uso e il montaggio.
                                                                      Leggere attentamente le presenti istruzioni per l‘uso
                                                                      HLOPRQWDJJLRHRVVHUYDUHVRSUDWWXWWROHDYYHUWHQ]H
                                                                      sulla
                                                                      sicurezza in esso contenute.
                                                                      Ciò garantirà un montaggio sicuro e ottimale del pro-
                                                                      dotto.

                                                                                        PELIGRO
                                                                      Las instrucciones breves no sustituyen a las
                                                                      instrucciones de montaje y servicio.
                                                                      /HDHVWDVLQVWUXFFLRQHVGHPRQWDMH\VHUYLFLRFRQ
                                                                      detenimiento y respete en especial todas las indica-
                                                                      ciones de
                                                                      DGYHUWHQFLD\VHJXULGDG
                                                                      Así podrá montar el producto con seguridad y de
                                                                      forma óptima.
DE   Original Montageanleitung Adapter für Schubarm                                                        1
                                                                                    EN   Translation of the original installation manual Adapter for push arm
                                                                                    FR   Traduction de la notice de montage originale Adaptateur pour bras de poussée
                                                                                    IT   Traduzione delle istruzioni di montaggio originali Adattatore per braccio di spinta
                                                                                    ES   Traducción de las instrucciones de montaje originales Adaptador para brazo de empuje
                                              Art.-Nr. S11511-00001

                                              4        015862              918505
                                              SOMMER Antriebs- und                                                                                                                            1x
                                              Funktechnik GmbH

                                              Hans-Böckler-Straße 21–27
                                              73230 Kirchheim
                                              Germany

                                                  +49 (0)900-1800150
                                              • 0,14 €/min aus dem
                                                deutschen Festnetz.
                                                Mobilfunkpreise abweichend.
                                              • 0.14 €/min from fixed-line
                                                telephones in Germany.                                                                             1                                               2
Art.-Nr. S11503-00000_122018_0-DRE_Rev-A_DE

                                                Mobile charges may vary.
                                              • 0,14 €/min depuis une ligne
                                                fixe en Allemagne.
                                                Les tarifs de téléphonie
                                                mobile sont différents.
                                              • 0,14 €/minuto da rete fissa                                          “clic”                                                      “clic”
                                                tedesca. Le tariffe da cellulare
                                                possono variare.
                                              • 0,14 €/minuto desde la red de
                                                telefonía fija alemana. Precios
                                                diferentes para teléfonos móviles.            1.
                                              info@sommer.eu
                                              www.sommer.eu

                                              © Copyright 2018                                                                                                                           2.
                                              Alle Rechte vorbehalten.
                                              All rights reserved.
                                              Tous droits réservés.
                                              Tutti i diritti riservati.
                                              Reservados todos los derechos.
DE   Anbindung Home Automation                                                                                                                                                     2
                                                                                   EN   Interface Home Automation
                                                                                   FR   Liaison Domotique
                                                                                   IT   Collegamenti Home Automation
                                                                                   ES   Conexion Home Automation

                                                                                         Conex, Output OC

                                                                                          Conex:                                                                                                                                         Output OC:
                                                                                                                                                                                   KEYPAD

                                                                                                                                                                                                                      GND

                                                                                                                                                                                                                            OUT

                                                                                                                                                                                                                                  24 V
                                                                                                   KEYPAD

                                                                                                                                                                                            1
                                              SOMMER Antriebs- und
                                                                                                                                                                                                                                         DC 24 V max. 750 mA
                                              Funktechnik GmbH                                                                                      ON    S1
                                                                                                                                                                SOMMER
                                                                                                                                                                Antriebs- u.
                                                                                                                                                                Funktechnik GmbH

                                                                                                                                                                                            4
                                                                                                                                                  1234
                                              Hans-Böckler-Straße 21–27
                                                                                                                                               WL                         SOMMER
                                              73230 Kirchheim/Teck                                                                           24V/1A                       Antriebs- u.
                                                                                                                                                         ACCU
                                                                                                                                                                          FunktechnikGmb
                                                                                                                                                                                       b
                                              Germany                                                                                      COM                              T1       T2
                                                                                                        T1       T2
                                                                                                                                                                               GT-G-1
                                                                                                                                           Signal
                                                                                                                                                                            PCxxxxxxx
                                                  +49 (0) 900 1800-150                                                                     GND                                                              L`   N`   N           L

                                              • 0,14 €/min aus dem                                     T1         T2                       +24V

                                                                                                                                                                                                ~ 24 V AC
                                                deutschen Festnetz.
                                                                                                                                            gn            rt

                                                                                                                                   Light
                                                Mobilfunkpreise abweichend.                                                                  +             -
                                              • 0.14 €/min from ¿xed-line                                                                                                                                                                  GND                 OUT    DC +24 V
                                                telephones in Germany.
Art.-Nr. S10890-00000_022019_0-DRE_Rev-C_DE

                                                Mobile charges may vary.
                                                                                                                        ON                                                                                                                                            ON
                                              • 0,14 €/min depuis une ligne
                                                ¿xe en Allemagne.
                                                Les tarifs de téléphonie                                               1234                                                                                                                                          1234
                                                mobile sont différents.
                                              • 0,14 €/minuto da rete ¿ssa
                                                tedesca. Le tariffe da cellulare          Home Automation/
                                                possono variare.
                                                                                          Liaison Domotique
                                              • 0,14 €/minuto desde la red de
                                                                                                             §6HF
                                                telefonía ¿ja alemana. Precios
                                                diferentes para teléfonos móviles.
                                              info@sommer.eu
                                              www.sommer.eu
                                                                                                                       Feedback
                                              © Copyright 2019
                                                                                                                        DC +24 V
                                              Alle Rechte vorbehalten.
                                              All rights reserved.
                                              Tous droits réservés.
                                              Tutti i diritti riservati.
                                              Reservados todos los derechos.
S 9050 / S 9060 / S 9080 / S 9110 base+ / pro+ / A 800 XL
DE      Anbindung Home Automation                                                                                                                  3
                             EN      Interface Home Automation
                             FR      Liaison Domotique
                             IT      Collegamenti Home Automation
                             ES      Conexion Home Automation

                  Conex, Relay

                  Conex:                                                                                                                             Relay:
                           KEYPAD
                                                                                                          KEYPAD                                     AC 250 V max. 5 A

                                                                                                                   1
                                                                                                                                                     DC +24 V max. 5 A
                                                                                       SOMMER
                                                                           ON    S1    Antriebs- u.
                                                                                       Funktechnik GmbH

                                                                                                                   4
                                                                         1234
                                                                      WL                         SOMMER
                                                                    24V/1A                       Antriebs- u.
                                                                                ACCU
                                                                                                 FunktechnikGmb
                                                                                                              b
                                T1                                COM                              T1       T2
                                         T2
                                                                                                      GT-G-1
                                                                  Signal
                                                                                                   PCxxxxxxx
                                                                  GND                                                              L`   N`   N   L
                               T1         T2                      +24V

                                                                                                                       ~ 24 V AC
                                                                   gn            rt
                                                          Light

                                                                    +             -
                                                                                                                                                         NC      COM     NO

                                                ON                                                                                                                        ON

                                               1234                                                                                                                      1234

                  Home Automation/
                  Liaison Domotique
                                     §6HF

                                               Input NC
                                                   COM
                                               Input NO

S 9050 / S 9060 / S 9080 / S 9110 base+ / pro+ / A 800 XL
DE   Original Montageanleitung Beschlag für Torrahmen                                                                                                       4
                                                                                    EN   Translation of the original installation manual door frame bracket
                                                                                    FR   Traduction de la notice de montage originale ferrure pour cadre de porte
                                                                                    IT   Traduzione delle istruzioni di montaggio originali ferramenta per telaio della porta
                                                                                    ES   Traducción de las instrucciones de montaje originales herraje para marcos de puerta
                                              Art.-Nr. 10355-00001

                                              4        015862              996428                                                                                                  A                                                                             1
                                              SOMMER Antriebs- und
                                              Funktechnik GmbH

                                              Hans-Böckler-Straße 21-27
                                              73230 Kirchheim/Teck
                                              Germany                                                                                                                                                                       AFK_S10935-00001_432016_Rev.A

                                                                                                                                                                                                                                                            1x

                                                  +49 (0)900-1800150                                                                                                                   AFK_S10935-00001_432016_Rev.A

                                                                                                                                                                                                                       1x

                                              • 0,14 €/min aus dem
                                                deutschen Festnetz.
                                                Mobilfunkpreise abweichend.
                                              • 0.14 €/min from fixed-line
                                                telephones in Germany.
Art.-Nr. S10353-00000_382017_0-DRE_Rev-C_DE

                                                Mobile charges may vary.
                                              • 0,14 €/min depuis une ligne
                                                fixe en Allemagne.
                                                Les tarifs de téléphonie                                                                                                           2                                                                             3

                                                                                                                                                                      min. 25 mm
                                                mobile sont différents.
                                              • 0,14 €/minuto da rete fissa
                                                tedesca. Le tariffe da cellulare
                                                possono variare.
                                              • 0,14 €/minuto desde la red de
                                                telefonía fija alemana. Precios
                                                diferentes para teléfonos móviles.
                                              info@sommer.eu
                                              www.sommer.eu

                                              © Copyright 2017
                                              Alle Rechte vorbehalten.
                                              All rights reserved.
                                              Tous droits réservés.
                                              Tutti i diritti riservati.
                                              Reservados todos los derechos.
      S 9050 / S 9060 / S 9080 / S 9110 base+ / pro+ / tiga / tiga+ / A 550 L / A 800 XL
DE   Original Montageanleitung Beschlag für Torrahmen                                                                                 5
                             EN   Translation of the original installation manual door frame bracket
                             FR   Traduction de la notice de montage originale ferrure pour cadre de porte
                             IT   Traduzione delle istruzioni di montaggio originali ferramenta per telaio della porta
                             ES   Traducción de las instrucciones de montaje originales herraje para marcos de puerta

                                                            B                                                                                                  1

                                                                                                                          AFK_S10935-00001_432016_Rev.A

                                                                                                                                                          1x

                                                                                     AFK_S10935-00001_432016_Rev.A

                                                                                                                     1x

                                                            2                                                                                                  3
                                               min. 25 mm

S 9050 / S 9060 / S 9080 / S 9110 base+ / pro+ / tiga / tiga+ / A 550 L / A 800 XL
DE   Original Montageanleitung Bowdenzug Set
                                                                                   EN   Translation of the original installation manual Bowden wire                             6
                                                                                   FR   Traduction de la notice de montage originale câble Bowden
                                                                                   IT   Traduzione delle istruzioni di montaggio originali tirante Bowden
                                                                                   ES   Traducción de las instrucciones de montaje originales transmisión Bowden
                                              Art.-Nr.      1612

                                                                                                                                                                   1612             1620
                                                4 015862    016126

                                              Art.-Nr.      1620

                                                                                              Ø 3 mm
                                                4 015862    016201                                             10 mm                                                           2x    6x
                                              SOMMER Antriebs- und                                10 mm   2x
                                              Funktechnik GmbH                                                                                       2x                   2x
                                              Hans-Böckler-Straße 21–27
                                              73230 Kirchheim/Teck
                                              Germany

                                                 +49 (0)900-1800150
                                              • 0,14 €/min aus dem
                                                deutschen Festnetz.
                                                Mobilfunkpreise abweichend.
                                              • 0.14 €/min from fixed-line
Art.-Nr. S11533-00000_252018_0-DRE_Rev-D_DE

                                                telephones in Germany.
                                                Mobile charges may vary.
                                              • 0,14 €/min depuis une ligne
                                                fixe en Allemagne.
                                                Les tarifs de téléphonie
                                                mobile sont différents.                                                             3.          2.
                                              • 0,14 €/minuto da rete fissa
                                                tedesca. Le tariffe da cellulare                                                               1.
                                                possono variare.                                                                                                                       3.
                                              • 0,14 €/minuto desde la red de                                                                                                  2.
                                                telefonía fija alemana. Precios
                                                diferentes para teléfonos móviles.

                                              info@sommer.eu
                                              www.sommer.eu                                                            3.
                                                                                                                                                                               1.
                                              © Copyright 2018
                                              Alle Rechte vorbehalten.                                                 2.
                                              All rights reserved.
                                              Tous droits réservés.
                                              Tutti i diritti riservati.                                               1.
                                              Reservados todos los derechos.

      S 9050 / S 9060 / S 9080 / S 9110 base+ / pro+ / tiga / tiga+ / A 400 S / A550 L / A 800 XL
DE   Original Montageanleitung Bowdenzug Set
                               EN   Translation of the original installation manual Bowden wire                                                                                                                                                                               7
                               FR   Traduction de la notice de montage originale câble Bowden
                               IT   Traduzione delle istruzioni di montaggio originali tirante Bowden
                               ES   Traducción de las instrucciones de montaje originales transmisión Bowden

      1612                                                                                                                                              1620
                                                                                                                                                                                                                                                                         1.       2.
                                                                                                                                           1.

                                                                                                                                                2.

  10 mm                                                                                                                                              10 mm

                                     i   DE
                                              AC
                                              Tor HTU
                                         EN   liegemus
                                                          NG
                                              über ndess stop
                                                   prüfe 50 pen – Ein
                                              CA         n mm undklem
                                              GateUTI und hohe
                                                                         reve
                                         FR   on musON wenn s
                                                 the
                                              prob      t stop
                                                     grou
                                                                          Hind
                                                              – Ris nötig ernis
                                                                                mg
                                                                              rsier
                                                                                      efa
                                                                                    en, hr!
                                                                                                                                                                            i   DE
                                                   lems                                  wenn
                                                           nd. and k          vom
                                              ATT , com                                trifft.                                                                                       AC
                                                               Regu of               Fach
                                              La    ENT miss reve    larlyrseinju
                                                                                                 es
                                                                                               Funk
                                                                                           man auf
                                                                                                                                                                                     Tor  HTU
                                              un porte
                                                 obst doit
                                              Vérif        ION ion chec        when ry            n tion
                                                                                                           ein                                                                  EN   liegemus
                                                                                                                                                                                                 NG
                                                                                                                am                                                                   über ndess stop
                                              par ier acle s’arr–
                                                                         a spec          from einst rege                                                                                               – Ein
                                                                                 k theit hits                       Bode
                                                                                                           ellen lmäß                                                                     prüfe 50 pen
                                                  un régusur êter    Ris                                                                                                             CA
                                                                                                a 50jam
                                                                                 ialist gate                                                                                                    n mm undklem
                                                     spéc lièrele          que                                    lasseig n                                                          GateUTI und hohe
                                                                   sol et
                                                           ialist men
                                                                                        tech func     mmmin                                                                                                     reve
                                                                                                                                                                                                                       mg
                                                                        quis’inv d’é           nicia tion.highg! n.                                                             FR   on musON wenn s
                                                                                                                                                                                                                 Hindrsier
                                                                 e si t le fait erse cra
                                                                                                     n
                                                                                                                                                                                        the
                                                                                                                                                                                     prob      t stop– Ris nötig ernis       efa
                                                                      nécebon 50 r                           If obst                                                                        grou                           en, hr!
                                                                                        lorsqsem with there                                                                               lems                                  wenn
                                                                                foncmm
                                                                            ssair                              read     acle                                                         ATT , com    nd. and k          vom
                                                                                          de u’elleent                                                                                                                        trifft.
                                                                                  e. tionn haut
                                                                                                                      are                                                                             Regu of               Fach
                                                                                                        renc!
                                                                                                                    justi any                                                        La    ENT miss reve    larlyrseinju
                                                                                                                                                                                                                                        es
                                                                                                                                                                                                                                      Funk
                                                                                                                                                                                                                                  man auf
                                                                                             emen eur.                   ng                                                          un porte                                                     ein
                                                                                                              ontre          it.                                                        obst doit
                                                                                                                                                                                     Vérif        ION ion chec        when ry            n tion am
                                                                                                     t et                                                                                                       a spec          from einst rege
                                                                                                          faire                                                                      par ier acle s’arr–                k theit hits                      Bode
                                                                                                                                                                                                            Ris                                   ellen lmäß
                                                                                                                                                                                         un régusur êter
                                                                                                                                                                                                                                       a 50jam
                                                                                                                 régle                                                                                                  ialist gate
                                                                                                                                                                                            spéc lièrele          que                                   lasseig n
                                                                                                                      r                                                                                   sol et
                                                                                                                                                                                                  ialist men
                                                                                                                                                                                                                               tech func     mmmin
                                                                                                                                                                                                               quis’inv d’é           nicia tion.highg! n.
                                                                                                                                                                                                        e si t le fait erse cra
                                                                                                                                                                                                             nécebon 50 r                   n
                                                                                                                                                                                                                                               withIf there
                                                                                                                                                                                                                                                         obst
                                                                                                                                                                                                                       fonc
                                                                                                                                                                                                                   ssair   mmlorsqsem                read     acle
                                                                                                                                                                                                                                 de u’elleent               are
                                                                                                                                                                                                                         e. tionn haut                    justi any
                                                                                                                                                                                                                                    emen eur.  renc!           ng
                                                                                                                                                                                                                                                     ontre         it.
                                                                                                                                                                                                                                            t et
                                                                                                                                                                                                                                                 faire
                                                                                                                                                                                                                                                       régle
                                                                                                                                                                                                                                                            r

                                                                                                                                   min
                                                                                                                                      .2
                                                                                                                                         0m
                                                                                                                                           m

                                                                                                                                                               min. 20 mm

   min. 20 mm

S 9050 / S 9060 / S 9080 / S 9110 base+ / pro+ / tiga / tiga+ / A 400 S / A550 L / A 800 XL
DE   Original Montageanleitung Elektroschloss                                                                                                                     8

                                                                            EN   Translation of the original installation manual Electric lock
                                                                            FR   Traduction de la notice de montage originale Serrure électrique
                                                                            IT   Traduzione delle istruzioni di montaggio originali Elettroserratura
                                                                            ES   Traducción de las instrucciones de montaje originales Cierre eléctrico

                                       Art.-Nr. 3205V003
                                                                                                                                  Technische Daten                  Nennspannung: DC 24 V        Nennleistungsaufnahme: 15 W
                                                                                                                                  Technical data                    Rated voltage: DC 24 V       Rated power consumption: 15 W
                                                                                                                                  Caractéristiques techniques       Tension nominale : CC 24 V   Puissance nominale absorbée : 15 W
                                                                                                                                  Dati tecnici                      Tensione nominale: DC 24 V   Potenza nominale assorbita: 15 W
                                                                                                                                  Datos técnicos                    Tensión nominal: 24 V CC     Consumo de potencia nominal: 15 W
                                       4     015862           923455
                                       SOMMER Antriebs- und
                                       Funktechnik GmbH

                                       Hans-Böckler-Straße 21–27
                                       73230 Kirchheim/Teck
                                       Germany

                                           +49 (0)900-1800150                                                                      X = mm   0–4   5–9   10–14 15–19 20–24 25–29 30–34 35–39 40–44 45–49 50–54 55–59 60–64 65–69 70–74 75–79
                                                                                                                                   Y = mm    20    25     30    35    40    45    50    55    60    65    70    75    80    85    90    95
                                       • 0,14 €/min aus dem
                                         deutschen Festnetz.
                                         Mobilfunkpreise abweichend.
                                       • 0.14 €/min from fixed-line
                                         telephones in Germany.
                                                                                                                                                  X
                                         Mobile charges may vary.
                                       • 0,14 €/min depuis une ligne
                                         fixe en Allemagne.
                                                                                                                                                  Y       10 ≥ 25
Art.-Nr. 12251_202018_0-DRE_Rev-G_DE

                                         Les tarifs de téléphonie
                                         mobile sont différents.
                                       • 0,14 €/minuto da rete fissa
                                         tedesca. Le tariffe da cellulare                                                                                                    17                                                     17
                                         possono variare.
                                       • 0,14 €/minuto desde la red de
                                         telefonía fija alemana. Precios

                                                                                                                                                                                                                                         33
                                                                                                                                                                                    33
                                         diferentes para teléfonos móviles.

                                       info@sommer.eu                                                                                                                        10                                                     10
                                       www.sommer.eu

                                       © Copyright 2018
                                       Alle Rechte vorbehalten.
                                       All rights reserved.
                                       Tous droits réservés.
                                       Tutti i diritti riservati.
                                       Reservados todos los derechos.

     twist 200 E / twist 200 EL / twist 350 / twist XL / twist AM / twist UG / twist UG+ / jive 200 E
DE          Original Montageanleitung Elektroschloss                                                                    9

                                   EN          Translation of the original installation manual Electric lock
                                   FR          Traduction de la notice de montage originale Serrure électrique
                                   IT          Traduzione delle istruzioni di montaggio originali Elettroserratura
                                   ES          Traducción de las instrucciones de montaje originales Cierre eléctrico

                                                2 x 0,5 mm²                   A                                                        B                              C

                                                                                                                                                        2 x 0,5 mm²

                                                                                                                               2 x 0,5 mm²                  2 x 0,5 mm²

                                                                                                                                             4
                                                                                                4
             4

                                                                                                    A                                                B + C

                                                                                                                        17
                                                                                                               52
                                               41
                                                      4

                                                                                                                        76,5
                            103
                                  66

                                       2x ෘ6
                                          

                                                                12
                                                                    4
                                                                                                                               ෘ6

                                                                                                                         3x

                                                                                                        124
                                                               3x
                                                          67

                                                                    ෘ6
                                                                     

                                                                                                                                                 +
                                                                                                               67
                                                                                   52

                                                                    76
                                                                         ,5

                                                                              17        –                                                        –
                                                                                            +

twist 200 E / twist 200 EL / twist 350 / twist XL / twist AM / twist UG / twist UG+ / jive 200 E
DE   Original Montageanleitung Entriegelung Set                                                                         10

                                                                                   EN   Translation of the original installation manual Release set
                                                                                   FR   Traduction de la notice de montage originale Kit de déverrouillage
                                                                                   IT   Traduzione delle istruzioni di montaggio originali Set sblocco
                                                                                   ES   Traducción de las instrucciones de montaje originales Juego de desbloqueo

                                              Art.-Nr. S11142-00001

                                                                                                                                                 a           b   c       d   e          f   h

                                              4     015862           951571
                                              SOMMER Antriebs- und
                                              Funktechnik GmbH                                                                                           i           k

                                              Hans-Böckler-Straße 21–27
                                              73230 Kirchheim/Teck                                                                   8 mm                        g
                                                                                                       4 mm                         10 mm
                                              Germany                                                  8 mm   Torx 25               13 mm   3x

                                                  +49 (0)900-1800150
                                              • 0,14 €/min aus dem
                                                                                                                                                                 j
                                                deutschen Festnetz.
                                                Mobilfunkpreise abweichend.
                                              • 0.14 €/min from fixed-line
Art.-Nr. S11245-00000_202018_0-DRE_Rev-A_DE

                                                telephones in Germany.
                                                Mobile charges may vary.
                                              • 0,14 €/min depuis une ligne                                                                                                                                     1
                                                fixe en Allemagne.
                                                Les tarifs de téléphonie
                                                mobile sont différents.                                                                                                          4 mm
                                                                                                                                                                                 8 mm
                                              • 0,14 €/minuto da rete fissa                                                                                                                      A
                                                tedesca. Le tariffe da cellulare
                                                possono variare.                                                                                                                            4 mm
                                              • 0,14 €/minuto desde la red de
                                                telefonía fija alemana. Precios                 a              b         e                        i
                                                diferentes para teléfonos móviles.
                                                                                                                                f
                                              info@sommer.eu
                                              www.sommer.eu
                                                                                                                                                     j                                              8 mm
                                                                                                                                                                                                           B
                                              © Copyright 2018                                                                       g
                                              Alle Rechte vorbehalten.                             A               B
                                                                                               d         C                  h                        k
                                              All rights reserved.
                                              Tous droits réservés.
                                              Tutti i diritti riservati.
                                              Reservados todos los derechos.

      twist AM
DE   Original Montageanleitung Entriegelung Set                                                                   11

            EN   Translation of the original installation manual Release set
            FR   Traduction de la notice de montage originale Kit de déverrouillage
            IT   Traduzione delle istruzioni di montaggio originali Set sblocco
            ES   Traducción de las instrucciones de montaje originales Juego de desbloqueo

                                  2                                                          3                                     4

  Torx 25                                   10 mm                                                 8 mm
                                                                                                 13 mm

                                  5                                                          6                                     7
                                                                                                              I   I   I   I

                                                                                                              0
                                                                                                                  0
                                                                                                                  0
                                                                                                                  0
                                                                                                              9   9 9 9

                                                                                                           Art.-Nr.
                                                                                                         S11141-00001

twist AM
DE   Original Montageanleitung Beschlag für Flügeltor                                                                                                         12

                                                                                   EN   Translation of the original installation manual for folding gate armature
                                                                                   FR   Traduction de la notice de montage originale de ferrure pour portes battantes
                                                                                   IT   Traduzione delle istruzioni di montaggio originali ferratura per cancello ad anta
                                                                                   ES   Traducción de las instrucciones de montaje originales herraje para puertas de hojas giratorias

                                              Art.-Nr. S10171-00002                                                                                                              ~ 30
                                                                                                                                                                                        0 mm

                                                                                                                                                                                                       2
                                                                                                                                                                                                           3

                                                                                                                                                                                                                                             1
                                                                                                                                                                                                                    1
                                                 4    015862         911308                                                                                                                        m
                                                                                                                                                                                                                                         2            3
                                                                                                                                                                                               m
                                                                                                                                                                                           =
                                                                                                                                                                                     B
                                              SOMMER Antriebs- und
                                              Funktechnik GmbH                                                                                          =
                                                                                                                                                            m
                                                                                                                                                                m
                                                                                                                                                                             =
                                                                                                                                                                                 B
                                                                                                                                                                                     m
                                                                                                                                                                                         m
                                                                                                                                                    A                    A       0                              2
                                                                                                                                                                              80
                                                                                                                                                                     .   2.
                                              Hans-Böckler-Straße 21–27                                                                                     m
                                                                                                                                                                ax
                                                                                                                                                                                                                                     DIN EN 13241
                                              73230 Kirchheim/Teck
                                              Germany

                                                 +49 (0)900-1800150
                                              • 0,14 €/min aus dem
                                                deutschen Festnetz.
                                                Mobilfunkpreise abweichend.
                                              • 0.14 €/min from fixed-line
Art.-Nr. S10170-00001_322018_0-DRE_Rev-D_DE

                                                telephones in Germany.
                                                Mobile charges may vary.
                                                                                                  6x                    1                                                    2                                          3                                 4
                                              • 0,14 €/min depuis une ligne
                                                fixe en Allemagne.
                                                Les tarifs de téléphonie
                                                mobile sont différents.
                                              • 0,14 €/minuto da rete fissa
                                                tedesca. Le tariffe da cellulare
                                                possono variare.
                                              • 0,14 €/minuto desde la red de
                                                telefonía fija alemana. Precios
                                                diferentes para teléfonos móviles.

                                              info@sommer.eu
                                              www.sommer.eu                                                             5                                                    6                             6x           7                                 8

                                              © Copyright 2018
                                              Alle Rechte vorbehalten.                                                                                                                                                      “clic”
                                              All rights reserved.
                                              Tous droits réservés.
                                              Tutti i diritti riservati.
                                              Reservados todos los derechos.

      S 9050 / S 9060 / S 9080 / S 9110 pro+ / tiga / tiga+
DE   Original Montageanleitung Beschlag für Flügeltor                                                                                     13

                                           EN   Translation of the original installation manual for folding gate armature
                                           FR   Traduction de la notice de montage originale de ferrure pour portes battantes
                                           IT   Traduzione delle istruzioni di montaggio originali ferratura per cancello ad anta
                                           ES   Traducción de las instrucciones de montaje originales herraje para puertas de hojas giratorias

                                                     9                                                                                      10                                                 11
                      3.                                    A                                         B                                                                         2.
                                      3.
                                                                1               2.020 mm                  2                2.040 mm
                                                                                                                                                                      2.
                                                                                                                                                                                          3.

                                                                                                                                                                 3.
                       2.
                                                                                 2.040 mm                                  2.020 mm                                        1.
                                                                2                                         1
            1.
                                                                                                                                                            1.

                                                                    12                                                       13                                                                14
            <   90°                                                                     °
                                                                                 < 90                                                            > 90
                                                                                                                                                        °

                                                                    15

                                 2.

                            3.

                                      1.

S 9050 / S 9060 / S 9080 / S 9110 pro+ / tiga / tiga+
DE   Original Montageanleitung Gummipro¿l passiv                                                          14
                                                                                    EN   Translation of the original installation manual Rubber pro¿le passive
                                                                                    FR   Traduction de la notice de montage originale Pro¿lé en caoutchouc passif
                                                                                    IT   Traduzione delle istruzioni di montaggio originali Pro¿lo di gomma passivo
                                                                                    ES   Traducción de las instrucciones de montaje originales Per¿l de goma pasivo
                                              Art.-Nr. S11935-00001
                                                                                                                                      S11935-00001

                                                                                                                                                                            1.         2.
                                              4        015862              910264

                                              SOMMER Antriebs- und
                                              Funktechnik GmbH

                                              Hans-Böckler-Straße 21–27
                                              73230 Kirchheim/Teck
                                              Germany
                                                                                                                                                                            3.         4.
                                                  +49 (0) 900 1800-150
                                              • 0,14 €/min aus dem
                                                deutschen Festnetz.
                                                Mobilfunkpreise abweichend.
                                              • 0.14 €/min from ¿xed-line
                                                telephones in Germany.
                                                                                              S11938-00001                                                   S11937-00001
Art.-Nr. S11943-00000_492018_0-DRE_Rev-A_DE

                                                Mobile charges may vary.
                                              • 0,14 €/min depuis une ligne
                                                ¿xe en Allemagne.
                                                Les tarifs de téléphonie
                                                mobile sont différents.
                                              • 0,14 €/minuto da rete ¿ssa
                                                tedesca. Le tariffe da cellulare
                                                possono variare.
                                                                                                                                                                                 50x        25x
                                              • 0,14 €/minuto desde la red de
                                                telefonía ¿ja alemana. Precios
                                                diferentes para teléfonos móviles.
                                              info@sommer.eu                                                                                                 S11936-00001
                                              www.sommer.eu

                                              © Copyright 2018                                                                                                        2x

                                              Alle Rechte vorbehalten.                                                                                          1x
                                              All rights reserved.
                                              Tous droits réservés.
                                              Tutti i diritti riservati.                                                              1x 25 m                                     2x         1x
                                              Reservados todos los derechos.
DE   Original Montageanleitung Gummipro¿l passiv                                                                    15
EN   Translation of the original installation manual Rubber pro¿le passive
FR   Traduction de la notice de montage originale Pro¿lé en caoutchouc passif
IT   Traduzione delle istruzioni di montaggio originali Pro¿lo di gomma passivo
ES   Traducción de las instrucciones de montaje originales Per¿l de goma pasivo

                                     17 mm              28 mm                                                      25 mm

 1               2

                                              46 mm

                                                                                                                                45 mm
                                                                     ~20 mm                             ~20 mm
                                                                              ~250 mm         ~250 mm
                                    S11936-00001      S11937-00001                      1/2                      S11935-00001

                                                                                                 3.

                                                                                                 2.

         1.
DE   Original Montage- und Betriebsanleitung HomeLink Modul                                                          16

                                                                                              EN   Translation of the original installation manual HomeLink module
                                                                                              FR   Traduction de la notice de montage originale HomeLink module
                                                                                              ES   Traducción de las instrucciones de montaje originales HomeLink módulo

                                                             Art. - Nr. S11004-00001
                                                                                                                                                      434,42 MHz                                 1
                                                                                                              min.
                                                                                                           DOM: 05.2017

                                                                                                                          som4.me/man   som4.me/mrl

                                                                                 ESD                                              USART
                                                                                                                                                 2                                           3   4a   6-Pin   4b   4-Pin

                                                             SOMMER Antriebs- und
                                                             Funktechnik GmbH

                                                             Hans-Böckler-Straße 21–27
                                                             73230 Kirchheim
                                                             Germany
HomeLink-Modul_S11762-00000_032019_0-DRE_Rev-B_DE-EN-FR-ES

                                                                                                       5                                              6                                          7
                                                                +49 (0)900-1800150
                                                             • 0,14 €/min aus dem
                                                                                                                                                                   Turn Page
                                                               deutschen Festnetz.
                                                               Mobilfunkpreise abweichend.
                                                             info@sommer.eu
                                                             www.sommer.eu

                                                             © Copyright 2019                                                                                  Follw the steps on the back
                                                             Alle Rechte vorbehalten.
                                                             All rights reserved.
                                                             Tous droits réservés.
                                                             Tutti i diritti riservati.
                                                             Reservados todos los derechos.

         base / base+ / pro / pro+ / tiga / tiga+ / A550 L / A800 XL
DE HomeLink einlernen                                                 EN HomeLink programming                                                     ES Programación HomeLink                                                   FR Programmation du système HomeLink
                                                                                                                                                                                                                                                           17

1.    Für das erste Einlernen an einem SOMMER Antrieb, die äußeren    1.    For the first time programming with a SOMMER opener, press and        1.    Si es la primera vez que programa un dispositivo de apertura         1.    Pour la première programmation avec un automatisme
      HomeLink Tasten für ca. 30 Sekunden drücken. Erst loslassen           hold the outer 2 HomeLink buttons for approximately 30 seconds.             SOMMER, pulse la primera y tercera tecla de la unidad de control           SOMMER, appuyez sur la première et troisième touche du mod-
      wenn die HomeLink LED erloschen ist.                                  Release only when the HomeLink indicator light turns off.                   HomeLink y manténgalas pulsadas durante unos 30 segundos.                  ule de commande HomeLink et maintenez-les enfoncées pendant
                                                                                                                                                        No los suelte hasta que se apague la luz del indicador de                  30 secondes.
          INFORMATION                                                           INFORMATION                                                             HomeLink.                                                                  Relâcher les boutons uniquement lorsque le témoin lumineux du
          Diesen Schritt nicht ausführen um weitere Home-                       Do not perform this step when programming the                                                                                                      système HomeLink s’éteint.
          Link - Tasten einzulernen.                                            additional HomeLink buttons.                                                  INFORMACIÓN
                                                                                                                                                             No realice este paso al programar los botones                             INFORMATION
2.    Um sicherzustellen, dass der HomeLink Lermodus aktiviert ist,   2.    To ensure HomeLink is in the proper training mode, press and hold                adicionales de HomeLink.                                                  1HSDVHႇHFWXHUFHWWHpWDSHORUVGHODSURJUDP-
      jede Taste einzeln drücken und gedrückt halten.                       each of the buttons individually.                                                                                                                          mation de boutons HomeLink supplémentaires.
     Ÿ Die LED blinkt 2 Sekunden lang schnell und leuchtet an-             Ÿ Indicator light blinks rapidly for 2 seconds and then turns to a     2.    Para asegurarse de que HomeLink esté en el modo de aprendiza-
         schließend dauerhaft                                                 continuous light.                                                         je correcto, mantenga pulsado cada uno de los botones de mane-       2.    Pour vérifier que le système HomeLink est bien en mode appren-
                                                                                                                                                        ra individual.                                                             tissage, maintenir enfoncé chaque bouton individuellement.
          INFORMATION                                                                                                                                  Ÿ La luz indicadora parpadea rápidamente durante 2 segundos y              Ÿ Le témoin lumineux clignote rapidement pendant 2 secondes
          Die folgenden Schritte können von zwei Personen                       INFORMATION                                                                 luego se convierte en una luz continua.                                 puis s’allume en continu.
          schneller und leichter durchgeführt werden.                           A second person makes the following steps quick-
                                                                                er and easier.
3.    Die “Radio”- Taste am Laufwagen lokalisieren.                                                                                                          INFORMACIÓN                                                               INFORMATION
                                                                      3.    At the carriage, locate the radio button.                                        Una segunda persona puede realizar los pasos                              Les étapes ci-après sont plus rapides et faciles à
               RADIO
                           CH1                                                                                                                               que se indican a continuación de manera más                               mettre en œuvre avec l’aide d’une deuxième per-
                           CH2                                                                   CH1                                                         rápida y sencilla.                                                        sonne.
                           CH3                                                       RADIO
                                                                                                 CH2
                           CH4
           12 34

                                                                                                 CH3
                                                                                                 CH4                                              3.    En el carro, ubique el botón Radio.                                  3.    Localiser le bouton radio sur le chariot.

                                                                                 12 34
     ON

                                                                           ON                                                                                                 CH1                                                                       CH1
                                                                                                                                                                  RADIO                                                                     RADIO
                                                                                                                                                                              CH2                                                                       CH2
                   RESET    STATUS                                                                                                                                            CH3                                                                       CH3
                                                                                                   STATUS                                                                     CH4                                                                       CH4

                                                                                                                                                              12 34

                                                                                                                                                                                                                                        12 34
                                                                                         RESET
Fig. 1

                                                                                                                                                       ON

                                                                                                                                                                                                                                  ON
                                                                      Fig. 1
4.    Die Taste kurz drücken.
     Ÿ LED leuchtet.                                                  4.    Press and release the radio button.                                                       RESET    STATUS                                                           RESET     STATUS
                                                                           Ÿ LED is activated.
          INFORMATION                                                                                                                             Fig. 1                                                                     Fig. 1
          Sobald die Taste gedrückt wurde, bleiben ca.                          INFORMATION
          30 Sekunden Zeit, um mit dem nächsten Schritt                         Once the button is pressed, there are approxi-                    4.    Púlselo y luego suéltelo.                                            4.    Appuyer et relâcher le bouton radio.
          fortzufahren.                                                         mately 30 seconds in which to initiate the next                        Ÿ Se activará la luz LED.                                                  Ÿ La DEL est activée.
                                                                                step.
5.    Zum Fahrzeug zurückkehren und die gewünschte HomeLink -
                                                                                                                                                             INFORMACIÓN                                                               INFORMATION
      Taste für zwei Sekunden drücken.                                5.    Return to the vehicle and firmly press and hold the desired Home-                Cuando se pulsa el botón, se dispone de 30 se-                            Après avoir appuyé sur le bouton, vous disposez
6.    Gewünschte HomeLink - Taste erneut für zwei Sekunden drücken          Link button to be programmed for two seconds and release.                        gundos aproximadamente para iniciar el siguiente                          d’environ 30 secondes pour passer à l’étape suiv-
      um den Antrieb zu aktivieren.                                   6.    Repeat the „press/hold/release“ a second time to activate the door.              paso.                                                                     ante.
                                                                                                                                                                                                                             5.
                                                                                                                                                  5.    Regrese al vehículo y pulse y mantenga pulsado durante dos se-       6.    Revenez au véhicule, maintenez le bouton du système Home-
Für weitere Informationen:                                            For more information please visit:                                                gundos el botón HomeLink deseado para programarlo; luego,                  Link que vous voulez programmer pendant deux secondes et
www.homelink.com                                                      www.homelink.com                                                                  suéltelo.                                                                  relâchez-le.
                                                                                                                                                  6.    Repita las acciones de “pulsar / mantener presionado / soltar” por   7.    Répéter la procédure « appuyer/maintenir enfoncé/relâcher » une
                                                                                                                                                        segunda vez para activar la puerta.                                        deuxième fois pour activer la porte.

                                                                                                                                                  Para obtener información adicional, visite el siguiente si-                Pour de plus amples renseignements, veuillez visiter:
                                                                                                                                                  tio: www.homelink.com                                                      www.homelink
EN Translation of the original installation manual HomeLink Module                                                               18

                                                                                                       FR Traduction de la notice de montage originale HomeLink module
                                                                                                       ES Traducción de las instrucciones de montaje originales HomeLink módulo

                                                    Art.-Nr. S11003-00001
                                                                                                               310 MHz                                     1                                                                    USART
                                                                                                                                                                                                                                             2

                                                     4        015862                    917218

                                                                                  ESD
                                                    FCC / IC Statement (USA / Canada)

                                                    This device complies with FCC rules part 15. The
                                                    operation of this device is subject to the following
                                                                                                                                                       3    4a     6-Pin
                                                                                                                                                                                  4b    6-Pin
                                                                                                                                                                                                       4c    4-Pin
                                                                                                                                                                                                                            5
                                                    conditions:                                                                                                   6-Pole Socket        4-Pole Socket        6-Pole Socket

                                                    1) This device may not cause harmful interference,
                                                    and

                                                    2) This device must accept any interference recei-
                                                    ved, including interference that may cause undesired
                                                    operation!

                                                     Sommer USA, Inc.
                                                     1430 West Pointe Drive, Suite Q
                                                     Charlotte, NC 28214
                                                     United States of America

                                                             Tl +1 170 424-5787                                 6                                          7
HomeLink-Modul_S11762-00024_142019_0-DRE_Rev-B_US

                                                             Fax +1 704 424-7699                                             Turn Page
                                                     info@sommer-usa.com
                                                     www.sommer-usa.com

                                                    © Copyright 2018
                                                    All rights reserved.                                                 Follw the steps on the back

                                                    Reservados todos los derechos.
                                                    Tous droits réservés.

       2060 evo+/ 2080 evo+ / 2110 evo+
EN HomeLink programming                                                     ES Programación HomeLink                                                   FR Programmation du système HomeLink
                                                                                                                                                                                     19

1.    For the first time programming with a SOMMER opener, press and        1.    Si es la primera vez que programa un dispositivo de apertura         1.    Pour la première programmation avec un automatisme SOMMER
      hold all 3 HomeLink buttons for approximately 30 seconds.                   SOMMER evo+, mantenga pulsados los 3 botones de HomeLink                   evo+, maintenir enfoncés les 3 boutons du système HomeLink
      Release only when the HomeLink indicator light turns off.                   durante 30 segundos aproximadamente.                                       pendant environ 30 secondes.
                                                                                  No los suelte hasta que se apague la luz del indicador de                  Relâcher les boutons uniquement lorsque le témoin lumineux du
          INFORMATION                                                             HomeLink.                                                                  système HomeLink s’éteint.
          Do not perform this step when programming the
          additional HomeLink buttons.                                                  INFORMACIÓN                                                              INFORMATION
                                                                                       No realice este paso al programar los botones                             1HSDVHႇHFWXHUFHWWHpWDSHORUVGHODSURJUDP-
2.    To ensure HomeLink is in the proper training mode, press and hold                adicionales de HomeLink.                                                  mation de boutons HomeLink supplémentaires.
      each of the buttons individually.
     Ÿ Indicator light blinks rapidly for 2 seconds and then turns to a     2.    Para asegurarse de que HomeLink esté en el modo de aprendiza-        2.    Pour vérifier que le système HomeLink est bien en mode appren-
        continuous light.                                                         je correcto, mantenga pulsado cada uno de los botones de mane-             tissage, maintenir enfoncé chaque bouton individuellement.
                                                                                  ra individual.                                                            Ÿ Le témoin lumineux clignote rapidement pendant 2 secondes
For more information please visit:
                                                                                 Ÿ La luz indicadora parpadea rápidamente durante 2 segundos y                puis s’allume en continu.
www.sommer-usa.com/homelink
                                                                                      luego se convierte en una luz continua.
                                                                                                                                                       Pour de plus amples renseignements, veuillez visiter:
                                                                            Para obtener información adicional, visite el siguiente sitio:             www.sommer-usa.com/homelink
                                                                            www.sommer-usa.com/homelink

                        DANGER
                Danger of falling!
                Unsafe or defective ladders may tip and cause                                                                                                                 DANGER
                serious or fatal accidents.                                                        AVISO                                                              Danger de chute!
                ` Use only a non-slip, stable ladder.                                       Peligro de caída                                                          Les échelles non sécuritaires ou défectueus-
                                                                                            Las escaleras inseguras o defectuosas po-                                 es peuvent basculer et causer des accidents
                                                                                            drían inclinarse y provocar accidentes graves                             graves ou mortels.
          INFORMATION                                                                       o fatales.                                                                ` Utiliser uniquement une échelle stable
          A second person makes the following steps quick-                                                                                                              antidérapante.
          er and easier.                                                                    ` Utilice solo una escalera estable y antidesli-
                                                                                              zante.
3.    At the carriage, locate the radio button.                                                                                                                  INFORMATION
                                                                                       INFORMACIÓN                                                               Les étapes ci-après sont plus rapides et faciles à
                RADIO
                            CH1                                                        Una segunda persona puede realizar los pasos                              mettre en œuvre avec l’aide d’une deuxième per-
                            CH2                                                        que se indican a continuación de manera más                               sonne.
                            CH3
                                                                                       rápida y sencilla.                                              3.    Localiser le bouton radio sur le chariot.
                            CH4
            12 34

                                                                            3.    En el carro, ubique el botón Radio.
                                                                                                                                                                                  CH1
     ON

                                                                                                                                                                      RADIO
                                                                                                        CH1                                                                       CH2
                                                                                            RADIO                                                                                 CH3
                                                                                                        CH2
                              STATUS                                                                                                                                              CH4

                                                                                                                                                                  12 34
                    RESET                                                                               CH3
                                                                                                        CH4
                                                                                        12 34

                                                                                                                                                            ON
                                                                                 ON

4.    Press and release the radio button.
     Ÿ    LED is activated.                                                                                                                                               RESET     STATUS
                                                                                                RESET    STATUS
          INFORMATION
          Once the button is pressed, there are approxi-                                                                                               4.    Appuyer et relâcher le bouton radio.
          mately 30 seconds in which to initiate the next                   4.    Púlselo y luego suéltelo.                                                 Ÿ La DEL est activée.
          step.                                                                  Ÿ    Se activará la luz LED.                                                    INFORMATION
                                                                                       INFORMACIÓN                                                               Après avoir appuyé sur le bouton, vous disposez
5.    Return to the vehicle and firmly press and hold the desired Home-                Cuando se pulsa el botón, se dispone de 30 se-                            d’environ 30 secondes pour passer à l’étape suiv-
      Link button to be programmed for two seconds and release.                        gundos aproximadamente para iniciar el siguiente                          ante.
6.    Repeat the „press/hold/release“ a second time to activate the door.              paso.                                                           5.    Revenez au véhicule, maintenez le bouton du système Home-
      You may need to repeat this sequence for pressing the radio button    5.    Regrese al vehículo y pulse y mantenga pulsado durante dos se-             Link que vous voulez programmer pendant deux secondes et
      on the carriage and then pressing the HomeLink button in the vehi-          gundos el botón HomeLink deseado para programarlo; luego,                  relâchez-le.
      cle up to 3 times to complete the training process.                         suéltelo.                                                            6.    Répéter la procédure « appuyer/maintenir enfoncé/relâcher » une
                                                                            6.    Repita las acciones de “pulsar / mantener presionado / soltar” por         deuxième fois pour activer la porte.
For more information please visit:                                                segunda vez para activar la puerta.                                        Vous pouvez être amené à répéter cette séquence consistant à
www.homelink.com                                                                  Es posible que, para completar el proceso de aprendizaje, deba             appuyer sur le bouton radio du chariot, puis à appuyer sur le bou-
                                                                                  repetir hasta 3 veces esta secuencia de accionamiento del botón            ton du système HomeLink dans le véhicule jusqu’à 3 fois pour ach-
                                                                                  Radio del carro y luego del botón de HomeLink en el vehículo.              ever le processus d’apprentissage.

                                                                            Para obtener información adicional, visite el siguiente si-                Pour de plus amples renseignements, veuillez visiter:
                                                                            tio: www.homelink.com                                                      www.homelink.com
20
                                                                                    DE   Original Montageanleitung Isolator mit Magnet Set
                                                                                    EN   Translation of the original installation manual for set, isolator with magnet
                                                                                    FR   Traduction de la notice de montage originale kit isolateur avec aimant
                                                                                    IT   Traduzione delle istruzioni di montaggio originali isolatore con kit magneti
                                                                                    ES   Traducción de las instrucciones de montaje originales juego de aislador con imán
                                              Art.-Nr. 10462V001

                                                                                                                                                                                                                      Standard/Standard/Standard/
                                                                                                                                      1x                                                                              Standard/Estándar
                                                                                                                                                                    Ø 6 mm

                                              4        015862              963741

                                                                                                                                                16,8 mm
                                                                                                                                                          12,7 mm

                                                                                                          6 mm

                                                                                                                                                                             S10665 -00001 –212016 –OCE –Rev.A
                                              SOMMER Antriebs- und
                                              Funktechnik GmbH
                                                                                                                                           2x
                                              Hans-Böckler-Straße 21–27
                                              73230 Kirchheim/Teck
                                              Germany
                                                                                                                                                                                                                 1x
                                                  +49 (0)900-1800150
                                              • 0,14 €/min aus dem
                                                deutschen Festnetz.
                                                Mobilfunkpreise abweichend.
                                              • 0.14 €/min from fixed-line
                                                                                                                                                                             1                                                                      2
                                                telephones in Germany.
Art.-Nr. S10736-00001_322018_0-DRE_Rev-D_DE

                                                Mobile charges may vary.
                                              • 0,14 €/min depuis une ligne
                                                fixe en Allemagne.
                                                Les tarifs de téléphonie
                                                mobile sont différents.
                                              • 0,14 €/minuto da rete fissa
                                                tedesca. Le tariffe da cellulare
                                                possono variare.
                                              • 0,14 €/minuto desde la red de
                                                telefonía fija alemana. Precios
                                                diferentes para teléfonos móviles.
                                              info@sommer.eu
                                              www.sommer.eu

                                              © Copyright 2018
                                              Alle Rechte vorbehalten.
                                              All rights reserved.
                                              Tous droits réservés.
                                              Tutti i diritti riservati.
                                              Reservados todos los derechos.
      S 9050 / S 9060 / S 9080 / S 9110 base+ / pro+ / tiga / tiga+ / A 550 L / A 800 XL
21
                                 DE     Original Montageanleitung Isolator mit Magnet Set
                                 EN     Translation of the original installation manual for set, isolator with magnet
                                 FR     Traduction de la notice de montage originale kit isolateur avec aimant
                                 IT     Traduzione delle istruzioni di montaggio originali isolatore con kit magneti
                                 ES     Traducción de las instrucciones de montaje originales juego de aislador con imán

             Optional/Optionally/En option/
                                                                                                                                                1                  2
             Opzionale/Opcional

                                                                                                                             16,8 ±0,5 mm
                                              16,8 ±0,5 mm
                                                                               6 mm

                                                                         12,7 mm

                                                                                   Ø 6 mm

                                                               16,8 mm
                                                                         12,7 mm

                                                                                            S10665-S10665–212016–OCR–Rev.A
                                                                                                                                            6 mm

                                                                                                                                            3                      4

                                                                                                                                                    12,7 mm
                                                                                                                                                      6 mm

                                                                                                                                                                   5

S 9050 / S 9060 / S 9080 / S 9110 base+ / pro+ / tiga / tiga+ / A 550 L / A 800 XL
DE   Original Montageanleitung Isolator mit Magnet Set                                  22
                                                                                    EN   Translation of the original installation manual for set, isolator with magnet
                                                                                    FR   Traduction de la notice de montage originale kit isolateur avec aimant
                                                                                    IT   Traduzione delle istruzioni di montaggio originali isolatore con kit magneti
                                                                                    ES   Traducción de las instrucciones de montaje originales juego de aislador con imán
                                              Art.-Nr. 10462V002

                                              4        015862              910394

                                              SOMMER Antriebs- und
                                              Funktechnik GmbH
                                                                                                                                       2x
                                              Hans-Böckler-Straße 21–27
                                              73230 Kirchheim/Teck
                                              Germany                                                                                                              1x

                                                  +49 (0)900-1800150
                                              • 0,14 €/min aus dem
                                                deutschen Festnetz.
                                                Mobilfunkpreise abweichend.
                                              • 0.14 €/min from fixed-line
                                                                                                                                                     1                           2
                                                telephones in Germany.
Art.-Nr. S11924-00000_392018_0-DRE_Rev-A_DE

                                                Mobile charges may vary.
                                              • 0,14 €/min depuis une ligne
                                                fixe en Allemagne.
                                                Les tarifs de téléphonie
                                                mobile sont différents.
                                              • 0,14 €/minuto da rete fissa
                                                tedesca. Le tariffe da cellulare
                                                possono variare.
                                              • 0,14 €/minuto desde la red de
                                                telefonía fija alemana. Precios
                                                diferentes para teléfonos móviles.
                                              info@sommer.eu
                                              www.sommer.eu

                                              © Copyright 2018
                                              Alle Rechte vorbehalten.
                                              All rights reserved.
                                              Tous droits réservés.
                                              Tutti i diritti riservati.
                                              Reservados todos los derechos.
      S 9050 / S 9060 / S 9080 / S 9110 base+ / pro+ / tiga / tiga+ / A 550 L / A 800 XL
DE   Original Montageanleitung LIFTer Montagelaufwagen                                                          23

                                                                                   EN   Translation of the original installation manual LIFTer Installation carriage
                                                                                   FR   Traduction de la notice de montage originale LIFTer Chariot de montage
                                                                                   IT   Traduzione delle istruzioni di montaggio originali LIFTer Slitta motore
                                                                                   ES   Traducción de las instrucciones de montaje originales LIFTer Carro de montaje

                                              Art.-Nr. S10941-00001
                                                                                                                                                                                                        1

                                                                                                                                                                                              kg
                                                                                                                                                                                      0   0
                                                                                                                                                                                   .1
                                                                                                                                                                                ax
                                                                                                         10 mm                                                              M

                                              SOMMER Antriebs- und                            10 mm
                                              Funktechnik GmbH

                                              Hans-Böckler-Straße 21–27
                                              73230 Kirchheim/Teck
                                              Germany

                                                                                                                                                                        2                               3
                                                 +49 (0)900-1800150
                                              • 0,14 €/min aus dem                                                            10 mm
                                                deutschen Festnetz.
                                                Mobilfunkpreise abweichend.
                                              • 0.14 €/min from fixed-line
Art.-Nr. S11128-00000_372018_0-DRE_Rev-C_DE

                                                telephones in Germany.
                                                Mobile charges may vary.
                                              • 0,14 €/min depuis une ligne
                                                fixe en Allemagne.
                                                Les tarifs de téléphonie
                                                mobile sont différents.
                                              • 0,14 €/minuto da rete fissa
                                                tedesca. Le tariffe da cellulare
                                                possono variare.
                                              • 0,14 €/minuto desde la red de                                                     4                                     5                               6
                                                telefonía fija alemana. Precios                                           6x
                                                diferentes para teléfonos móviles.

                                              info@sommer.eu
                                              www.sommer.eu

                                              © Copyright 2018
                                              Alle Rechte vorbehalten.
                                              All rights reserved.
                                              Tous droits réservés.
                                              Tutti i diritti riservati.
                                              Reservados todos los derechos.

      S 9050 / S 9060 / S 9080 / S 9110 base+ / pro+ / tiga / tiga+ / A 550 L / A 800 XL
DE   Original Montageanleitung LIFTer Montagelaufwagen                                                                                                24

                               EN   Translation of the original installation manual LIFTer Installation carriage
                               FR   Traduction de la notice de montage originale LIFTer Chariot de montage
                               IT   Traduzione delle istruzioni di montaggio originali LIFTer Slitta motore
                               ES   Traducción de las instrucciones de montaje originales LIFTer Carro de montaje

                                         7                                      Durch Funkkanal 2 kann der Kurzschluß des Relais aufgehoben werden.           8                           9
                                                                                (Notfalllösung um bei einer Verklemmung den Laufwagen sicher zu
                                                                                entlasten.)

                                                                                The relay short-circuit can be cancelled via radio channel 2. (Emergency
                                                       STOP                     solution to reliably relieve the load on the carriage if jamming occurs.)

                                                                                Le canal radio 2 permet d’éliminer le court-circuit du relais. (Solution de
                                                                                secours permettant de décharger le chariot en toute sécurité en cas de
                                                                          2     blocage.)                                                                              min
                                                                                                                                                                             . 50
                                                                                                                                                                                    mm
                                                                                Attraverso il canale radio 2 è possibile interrompere il cortocircuito del
                                                                                relè. (Soluzione di emergenza per sbloccare in sicurezza la slitta motore
                                                                                in caso di bloccaggio.)
                                                              1                 A través del canal de radio 2 puede subsanarse el cortocircuito del relé.
                                                                                                                                                                   =
                                                                                (Solución de emergencia para descargar el carro de forma segura en caso
                                                                                de enclavamiento.)

                                         10                                                11                                                                 12                          13

                                         14                                                15

S 9050 / S 9060 / S 9080 / S 9110 base+ / pro+ / tiga / tiga+ / A 550 L / A 800 XL
'(   2ULJLQDO0RQWDJHDQOHLWXQJ/80,/LQH                                                                                                          25

                                                                                   (1   7UDQVODWLRQRIWKHRULJLQDOLQVWDOODWLRQPDQXDO/80,/LQH
                                                                                   )5   7UDGXFWLRQGHODQRWLFHGHPRQWDJHRULJLQDOH/80,/LQH
                                                                                   ,7   7UDGX]LRQHGHOOHLVWUX]LRQLGLPRQWDJJLRRULJLQDOL/80,/LQH
                                                                                   (6   7UDGXFFLyQGHODVLQVWUXFFLRQHVGHPRQWDMHRULJLQDOHV/80,/LQH

                                              $UW1U6
                                                                                                                                           Fu
                                                                                                                                          An nkte
                                                                                                                                         SO trieb chnik
                                                                                                                                           MM s- u
                                                                                                                                               ER   .
                                                                                                                                                        Gm
                                                                                                                                                          bH                                                            je Steuerung = max.
                                                                                                                                                                          1x                                                    1 x LUMI Line
                                                                                                                                                                                                                                1 x Output OC!
                                                                                                                                                                                                            ≈6,0 m
                                                              
                                                                                                                                                                                                                        each control unit = max.
                                                                                                                                      DC 24 V – 18 W                                                                           1 x LUMI Line
                                                                                               ø 4,0 mm                                                                                                                        1 x Output OC!
                                                                                               ø 8,0 mm                                                                                               10x
                                              6200(5$QWULHEVXQG                                                                                                                                                      chaque commande = max.
                                              )XQNWHFKQLN*PE+                                                 13 mm
                                                                                                                                                                                                                               1 x LUMI Line
                                                                                                                                                                                                                               1 x Output OC!
                                                                                                     13 mm                                                                               2x
                                                                                                                                                                                                             2x
                                                                                                                                                                                    1x                                  ogni centralina = max.
                                              +DQV%|FNOHU6WUD‰H±                                                                                                                                                        1 x LUMI Line
                                              '.LUFKKHLP7HFN                                                                  1x                                                      2x M4                             1 x Output OC!
                                                                                                                                                                                                                        cada cuadro = max.
                                              *HUPDQ\                                                                                                                                                                           1 x LUMI Line
                                                                                                                                                                                                                                1 x Output OC!

                                                    
                                              ‡ ¼PLQDXVGHP                                                                                                       1.240 mm
                                                GHXWVFKHQ)HVWQHW]
                                                0RELOIXQNSUHLVHDEZHLFKHQG
                                                                                                          ≈30–100 mm                                                                                              ≈30–100 mm
                                              ‡ ¼PLQIURP¿[HGOLQH                                                                                                 X mm
                                                WHOHSKRQHVLQ*HUPDQ\                                            5.                                                                                          5.
                                                0RELOHFKDUJHVPD\YDU\
                                              ‡ ¼PLQGHSXLVXQHOLJQH                                       4.                                                                                          4.
                                                ¿[HHQ$OOHPDJQH
                                                /HVWDULIVGHWpOpSKRQLH                                          3.                                                                                          3.
                                                PRELOHVRQWGLႇpUHQWV                                                                                                 ø 4,0 mm
                                              ‡ ¼PLQXWRGDUHWH¿VVD
$UW1U6BB'5(B5HY$B'(

                                                WHGHVFD/HWDULႇHGDFHOOXODUH                                                    1.                                                   1.
                                                SRVVRQRYDULDUH
                                              ‡ ¼PLQXWRGHVGHODUHGGH
                                                WHOHIRQtD¿MDDOHPDQD3UHFLRV
                                                GLIHUHQWHVSDUDWHOpIRQRVPyYLOHV
                                                                                                                         2.                                                                           2.
                                              LQIR#VRPPHUHX
                                              ZZZVRPPHUHX

                                              ‹&RS\ULJKW
                                              $OOH5HFKWHYRUEHKDOWHQ
                                              $OOULJKWVUHVHUYHG                                                                                             ≈6,0 m
                                              7RXVGURLWVUpVHUYpV
                                              7XWWLLGLULWWLULVHUYDWL
                                              5HVHUYDGRVWRGRVORVGHUHFKRV

      6666EDVHSUR$;/
'(     2ULJLQDO0RQWDJHDQOHLWXQJ/80,/LQH                                                                                                                                                26

                                                                   (1     7UDQVODWLRQRIWKHRULJLQDOLQVWDOODWLRQPDQXDO/80,/LQH
                                                                   )5     7UDGXFWLRQGHODQRWLFHGHPRQWDJHRULJLQDOH/80,/LQH
                                                                   ,7     7UDGX]LRQHGHOOHLVWUX]LRQLGLPRQWDJJLRRULJLQDOL/80,/LQH
                                                                   (6     7UDGXFFLyQGHODVLQVWUXFFLRQHVGHPRQWDMHRULJLQDOHV/80,/LQH

                                                     1.                   2.                        3.                                                            4.

                                                                                           
                                                                                       1.

                                                                                                                                                                                          GND

                                                                                                                                                                                                OUT

                                                                                                                                                                                                      24 V
                                                                                                                                                                       Funktechnik GmbH
                                                                                                                                                                       Antriebs- u.
                                                                                                                                                                        SOMMER

                                                                               2.
                                                                                                H
                                                                                                b
                                                                                                    m
                                                                                                           R . G
                                                                                                         E - u ik
                                                                                                        M s n
                                                                                                      M b h
                                                                                                     O ie c
                                                                                                    S ntr kte
                                                                                                     A un

                                                                                                                            G
                                                                                                                         N
                                                                                                                        D
                                                                                                      F

                                                                                                                                    O
                                                                                                                                U
                                                                                                                                T

                                                                                                                                        24
                                                                                                                                    V

                                                                                                                                                                                                                                                   ø 8,5 mm

                                                                                           
                                                                                                                                                                                                                             2.
                                                            Output OC:
                                                                                                             H
                                                                                                              b
                                                                                                                 m
                                                                                                                     R . G

                                                            DC 24 V max. 750 mA
                                                                                                                    E - u ik
                                                                                                                     b hn
                                                                                                                         O ie c
                                                                                                                        S ntr kte
                                                                                                                      s

                                                                                                                         A un

                                                                                                                                                 G
                                                                                                                            M

                                                                                                                                             N
                                                                                                                                             D
                                                                                                                          M

                                                                                                                          F

                                                                                                                                                         O
                                                                                                                                                     U
                                                                                                                                                     T

                                                                                                                                                             24
                                                                                                                                                         V

                                                                                                                                                                                                                                GND

                                                                                                                                                                                                                                      OUT

                                                                                                                                                                                                                                            24 V

                                                                                                                                                                                                             Funktechnik GmbH
                                                                                                                                                                                                             Antriebs- u.
                                                                                                                                                                                                                    SOMMER
                     H
                    b
                   m
           R . G
          E - u ik
         M s n
       M eb h
      O ri c
     S nt kte
      A un

                             G
                         N
                         D
       F

                                     O
                                 U
                                 T

                                         2
                                          4
                                     V

                                              24 V           GND          OUT DC +24 V
                                                                                                                                                                                                              1.
                                                      OUT                         ON

                                                                               1234

6666EDVHSUR$;/
DE   Original Montageanleitung LUMI Stick                                                                                 27
                                                                                    EN   Translation of the original installation manual LUMI Stick
                                                                                    FR   Traduction de la notice de montage originale LUMI Stick
                                                                                    IT   Traduzione delle istruzioni di montaggio originali LUMI Stick
                                                                                    ES   Traducción de las instrucciones de montaje originales LUMI Stick
                                              Art.-Nr. S11584-00001
                                                                                                                                                            24 mm                                   56 mm
                                                                                                                                                                                            48 mm             8 mm
                                                                                                                                                                         5 mm
                                                                                                                                                                                                       3 mm

                                              4        015862              917492

                                                                                                                                               28 mm

                                                                                                                                                                         SW 19
                                                                                             12 mm
                                              SOMMER Antriebs- und                                             19 mm
                                              Funktechnik GmbH

                                                                                                                                                                                      M12
                                              Hans-Böckler-Straße 21–27
                                              73230 Kirchheim/Teck
                                              Germany

                                                  +49 (0) 900 1800-150                      1x                                  1x
                                              • 0,14 €/min aus dem                                                                                                               1.                                    2.
                                                deutschen Festnetz.
                                                Mobilfunkpreise abweichend.                                                                                                                           A
                                              • 0.14 €/min from ¿xed-line
                                                                                                                                                            12 mm
                                                telephones in Germany.                                                               1x
Art.-Nr. S11748-00000_022019_0-DRE_Rev-A_DE

                                                Mobile charges may vary.
                                              • 0,14 €/min depuis une ligne
                                                ¿xe en Allemagne.
                                                Les tarifs de téléphonie                                                                                                                                           A
                                                mobile sont différents.
                                              • 0,14 €/minuto da rete ¿ssa                    ≈300 mm
                                                tedesca. Le tariffe da cellulare
                                                possono variare.
                                              • 0,14 €/minuto desde la red de
                                                telefonía ¿ja alemana. Precios
                                                diferentes para teléfonos móviles.
                                              info@sommer.eu
                                              www.sommer.eu
                                                                                            IP65
                                              © Copyright 2019
                                              Alle Rechte vorbehalten.
                                              All rights reserved.                         S11584-00001   DC 12...24 V/max. 25 mA                                    min. 4 mm
                                              Tous droits réservés.                         LED                            WH                                       max. 42 mm
                                              Tutti i diritti riservati.
                                              Reservados todos los derechos.
DE   Original Montageanleitung LUMI Stick                                    28
EN   Translation of the original installation manual LUMI Stick
FR   Traduction de la notice de montage originale LUMI Stick
IT   Traduzione delle istruzioni di montaggio originali LUMI Stick
ES   Traducción de las instrucciones de montaje originales LUMI Stick

                                  19 mm
                   3.                                                   4.
DE   Original Montageanleitung LUMI Strip                                                   29
                                                                                   EN   Translation of the original installation manual LUMI Strip
                                                                                   FR   Traduction de la notice de montage originale LUMI Strip
                                                                                   IT   Traduzione delle istruzioni di montaggio originali LUMI Strip
                                                                                   ES   Traducción de las instrucciones de montaje originales LUMI Strip
                                              Art.-Nr. S11479-00001

                                              Art.-Nr. S11480-00001

                                              Art.-Nr. S11481-00001
                                                                                                                                              IP65              1x 3,5 x 16
                                              SOMMER Antriebs- und                          3,0 mm
                                              Funktechnik GmbH                              7,0 mm

                                              Hans-Böckler-Straße 21–27
                                              73230 Kirchheim/Teck
                                              Germany

                                                  +49 (0) 900 1800-150
                                              • 0,14 €/min aus dem
                                                                                              S11479-00001    DC 24 V/4,5 W
                                                                                                                                                           1x
                                                deutschen Festnetz.
                                                Mobilfunkpreise abweichend.                   LED                     WH
                                              • 0.14 €/min from ¿xed-line
                                                telephones in Germany.
                                                                                                                                                                              ≈8,0 m
Art.-Nr. S11502-00000_022019_0-DRE_Rev-A_DE

                                                Mobile charges may vary.
                                              • 0,14 €/min depuis une ligne                   S11480-00001     DC 24 V/9 W
                                                ¿xe en Allemagne.
                                                Les tarifs de téléphonie                      LED                      YE
                                                mobile sont différents.
                                              • 0,14 €/minuto da rete ¿ssa
                                                tedesca. Le tariffe da cellulare                                      WH
                                                possono variare.
                                              • 0,14 €/minuto desde la red de
                                                telefonía ¿ja alemana. Precios                S11481-00001     DC 24 V/9 W
                                                diferentes para teléfonos móviles.
                                              info@sommer.eu                                  LED                      RD                                                     1x
                                              www.sommer.eu
                                                                                                                       GN
                                              © Copyright 2019
                                              Alle Rechte vorbehalten.
                                              All rights reserved.
                                              Tous droits réservés.
                                              Tutti i diritti riservati.
                                              Reservados todos los derechos.
DE   Original Montageanleitung LUMI Strip                                             30
                  EN   Translation of the original installation manual LUMI Strip
                  FR   Traduction de la notice de montage originale LUMI Strip
                  IT   Traduzione delle istruzioni di montaggio originali LUMI Strip
                  ES   Traducción de las instrucciones de montaje originales LUMI Strip

         7,0 mm                                                                           3,0 mm

1.                         2.                              4.                             5.       6.

                                                                                                        A +   B
                                                                                                   A

                                              3.
                                                                                                   B
     max. 3 mm
DE   Original Montageanleitung für Laser                                                      31
                                                                                EN   Translation of the original installation manual for laser
                                                                                FR   Traduction de la notice de montage originale de montage laser
                                                                                IT   Traduzione delle istruzioni di montaggio originali laser
                                                                                ES   Traducción de las instrucciones de montaje originales laser
                                           Art.-Nr. 10378
                                                                                                                                                                                           1
                                                                                                                                                                 1x

                                           SOMMER Antriebs- und
                                                                                              6 mm
                                           Funktechnik GmbH
                                                                                                                                                                 1x
                                                                                                                                                     ~60 %
                                           Hans-Böckler-Straße 21–27
                                           73230 Kirchheim
                                           Germany

                                               +49 (0)900-1800150                                                           2                                3                             4
                                           • 0,14 €/min aus dem                                              1.

                                                                                                                                                                                       R
                                             deutschen Festnetz.

                                                                                                                                                                          R

                                                                                                                                                                                     SE
                                                                                                                                                                        SE
                                                                                                                                                                      LA

                                                                                                                                                                                   LA
                                             Mobilfunkpreise abweichend.                                           ~60 %
                                           • 0.14 €/min from fixed-line
                                             telephones in Germany.
                                             Mobile charges may vary.
Art.-Nr. 46825V000_512017_0-DRE_Rev-E_DE

                                           • 0,14 €/min depuis une ligne
                                             fixe en Allemagne.
                                             Les tarifs de téléphonie
                                             mobile sont différents.                                     2. = 100 %
                                           • 0,14 €/minuto da rete fissa
                                             tedesca. Le tariffe da cellulare
                                             possono variare.
                                           • 0,14 €/minuto desde la red de
                                             telefonía fija alemana. Precios                                                 5                                A                             B
                                             diferentes para teléfonos móviles.
                                           info@sommer.eu
                                           www.sommer.eu

                                           © Copyright 2017
                                           Alle Rechte vorbehalten.
                                           All rights reserved.
                                           Tous droits réservés.                                                                                                      6 mm
                                           Tutti i diritti riservati.
                                           Reservados todos los derechos.
     S 9050 / S 9060 / S 9080 / S 9110 base+ / pro+ / tiga / tiga+
DE   Original Montageanleitung für Laser                                                                                        32
                             EN   Translation of the original installation manual for laser
                             FR   Traduction de la notice de montage originale de montage laser
                             IT   Traduzione delle istruzioni di montaggio originali laser
                             ES   Traducción de las instrucciones de montaje originales laser

                                                                          HINWEIS                                                INFORMATION
                                                                          Die Einstellungen des Lasers dürfen nicht              Der Laser entbindet den Fahrer nicht
                                                                          verändert werden, z. B. durch Ball spielende           von der Sorgfaltspflicht, sein Umfeld
                                                                          Kinder. Die Garage nach Aus- oder Einfahrt             zu beobachten und die notwendigen
 Laser Class 2                                                            schließen, um Veränderungen am Laser und               Abstände einzuhalten.
                                         100 %
                                                                          damit verbundene Sachschäden zu vermeiden.

                                                                          NOTE                                                   INFORMATION
                                                                          The laser setting must not be changed,                 The laser does not release the driver
                                                                          for example by children playing ball.                  from the obligation to exercise diligence
                                                                          Close the garage after driving in or out to            when observing the surroundings and
                                                                          prevent changes to the laser and damage                abiding by the necessary distances
                                                                          associated with this.                                  between the vehicle and other objects.

                                                                          REMARQUE                                               INFORMATIONS
                                                                          Ne pas modifier le réglage du laser, par ex.            Le laser ne décharge pas le conducteur
                                                                          lorsque des enfants jouent au ballon. Fermer           de son obligation de surveiller son
                                                                          le garage après être entré(ée) ou sorti(ie) pour       environ-nement et de respecter les
                                                                          éviter tout risque de modification du laser             distances de sécurité.
                                                                          et les dommages matériels consécutifs.

                                                                          AVVISO                                                 INFORMAZIONE
 Laser Class 2                           100 %                            Le impostazioni del laser non devono essere alte-      Il laser non esonera il conducente
                                                                          rate (fare attenzione, ad esempio, a bambini che       dal suo obbligo di prestare attenzione
                                                                          giocano a pallone). Dopo un‘entrata o un‘uscita,       all‘area circostante e di mantenere
                                                                          chiudere il garage per prevenire possibili alterazi-   le distanze minime richieste.
                                                                          oni al laser e conseguenti danni materiali.

                                                                          INDICACIÓN                                             INFORMACIÓN
                                                                          Los ajustes del láser no deben modificarse,             El láser no exime al conductor de la
                                                                          p. ej., por niños jugando con un balón.                obligación de obrar con diligencia,
                                                                          Cierre el garaje después de entrar o salir             de prestar atención a su alrededor
                                                                          para evitar modificaciones en el láser                  y de mantener las distancias
                                                                          y los correspondientes daños materiales.               necesarias.

S 9050 / S 9060 / S 9080 / S 9110 base+ / pro+ / tiga / tiga+
DE   Original Montageanleitung für Laufschiene Deckenaufhängung                                                                 33
                                                                                    EN   Translation of the original installation manual for ceiling bracket track
                                                                                    FR   Traduction de la notice de montage originale pour rail de roulement suspension plafonnière
                                                                                    IT   Traduzione delle istruzioni di montaggio originali per guida di staffa di fissaggio a soffitto
                                                                                    ES   Traducción de las instrucciones de montaje originales para riel de suspensión del techo
                                              Art.-Nr. S11451-00001

                                              4        015862              929013

                                              SOMMER Antriebs- und
                                              Funktechnik GmbH
                                                                                                                13 mm
                                              Hans-Böckler-Straße 21-27
                                              73230 Kirchheim/Teck                                    10 mm
                                              Germany

                                                  +49 (0)900-1800150
                                              • 0,14 €/min aus dem
                                                deutschen Festnetz.
                                                Mobilfunkpreise abweichend.
                                              • 0.14 €/min from fixed-line
                                                telephones in Germany.
                                                                                            1                                                                    2
Art.-Nr. S11454-00000_482017_0-DRE_Rev-A_DE

                                                Mobile charges may vary.
                                              • 0,14 €/min depuis une ligne
                                                                                                                        B
                                                fixe en Allemagne.
                                                Les tarifs de téléphonie
                                                mobile sont différents.
                                                                                                                                 A
                                              • 0,14 €/minuto da rete fissa
                                                tedesca. Le tariffe da cellulare
                                                possono variare.
                                              • 0,14 €/minuto desde la red de
                                                telefonía fija alemana. Precios
                                                diferentes para teléfonos móviles.
                                              info@sommer.eu
                                              www.sommer.eu
                                                                                                                                                                                                                10 mm     13 mm
                                              © Copyright 2017
                                              Alle Rechte vorbehalten.
                                              All rights reserved.
                                              Tous droits réservés.
                                              Tutti i diritti riservati.                                                                                                                                                 65 mm
                                              Reservados todos los derechos.
      S 9050 / S 9060 / S 9080 / S 9110 base+ / pro+ / tiga / tiga+ / A 550 L / A 800 XL                                                                                       (USA) 2040 / 2060 / 2080 / 2110 / evo / evo+ / pro+
DE   Original Montageanleitung Laufwagen Kontaktfeder Set
                                                                                   EN   Translation of the original installation manual Motor carriage contact spring set                     34
                                                                                   FR   Traduction de la notice de montage originale Kit de ressorts de contact pour chariot
                                                                                   IT   Traduzione delle istruzioni di montaggio originali Set molla di contatto slitta motore
                                                                                   ES   Traducción de las instrucciones de montaje originales Juego de resortes de contacto para carro

                                              Art.-Nr. S11607-00001
                                                                                                                                                                                                   1

                                              4     015862           917218
                                                                                                          10 mm

                                              SOMMER Antriebs- und                            10 mm
                                              Funktechnik GmbH

                                              Hans-Böckler-Straße 21–27
                                              73230 Kirchheim
                                              Germany

                                                                                                                                   2                                            3                  4
                                                  +49 (0)900-1800150                                                                                                                     6x
                                              • 0,14 €/min aus dem
                                                deutschen Festnetz.
                                                Mobilfunkpreise abweichend.
                                              • 0.14 €/min from fixed-line
Art.-Nr. S11609-00000_072018_0-DRE_Rev-A_DE

                                                telephones in Germany.
                                                Mobile charges may vary.
                                              • 0,14 €/min depuis une ligne
                                                fixe en Allemagne.
                                                Les tarifs de téléphonie
                                                mobile sont différents.
                                              • 0,14 €/minuto da rete fissa
                                                tedesca. Le tariffe da cellulare
                                                possono variare.
                                              • 0,14 €/minuto desde la red de                                                      5                                            6                  7
                                                telefonía fija alemana. Precios
                                                diferentes para teléfonos móviles.

                                              info@sommer.eu
                                              www.sommer.eu

                                              © Copyright 2018
                                              Alle Rechte vorbehalten.
                                              All rights reserved.
                                              Tous droits réservés.
                                              Tutti i diritti riservati.
                                              Reservados todos los derechos.

      S 9050 / S 9060 / S 9080 / S 9110 base+ / pro+ / tiga / tiga+ / A 550 L / A 800 XL
Vous pouvez aussi lire